PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_17800A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 826aa    MW: 90929.4 Da    PI: 4.8205
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_17800AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.29.5e-195096148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g+WT+eEd +l +av+ + g++Wk+Ia++++  Rt+ qc +rwqk+l
  Oropetium_20150105_17800A 50 KGNWTPEEDAILSRAVQTYQGKNWKKIAECFP-DRTDVQCLHRWQKVL 96
                               79******************************.************986 PP

2Myb_DNA-binding62.39.6e-20102148148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                +g+W++eEde++v+ v+++G++ W+tIa+ ++ gR +kqc++rw+++l
  Oropetium_20150105_17800A 102 KGPWSKEEDEIIVQMVNKYGPKKWSTIAQALP-GRIGKQCRERWHNHL 148
                                79******************************.*************97 PP

3Myb_DNA-binding48.81.6e-15154196145
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                + +WT+eE+  l++a++++G++ W+   + ++ gRt++++k++w+
  Oropetium_20150105_17800A 154 KEAWTQEEEITLIHAHRMYGNK-WAELTKFLP-GRTDNSIKNHWN 196
                                579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.6774596IPR017930Myb domain
SuperFamilySSF466895.38E-1948110IPR009057Homeodomain-like
SMARTSM007173.1E-174998IPR001005SANT/Myb domain
PfamPF002493.2E-165096IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.6E-2451109IPR009057Homeodomain-like
CDDcd001675.27E-155296No hitNo description
PROSITE profilePS5129431.9297152IPR017930Myb domain
SuperFamilySSF466891.8E-3199195IPR009057Homeodomain-like
SMARTSM007171.5E-18101150IPR001005SANT/Myb domain
CDDcd001672.23E-16104148No hitNo description
PfamPF139212.6E-18105165No hitNo description
Gene3DG3DSA:1.10.10.608.5E-27110155IPR009057Homeodomain-like
SMARTSM007172.2E-14153201IPR001005SANT/Myb domain
PROSITE profilePS5129419.815153203IPR017930Myb domain
CDDcd001673.21E-11156196No hitNo description
Gene3DG3DSA:1.10.10.603.4E-21156203IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0032875Biological Processregulation of DNA endoreduplication
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 826 aa     Download sequence    Send to blast
MTSDKGKVSK KAGQASGVTP PPCEGGASRE PQKQRSLNGR TTGPTRRSTK GNWTPEEDAI  60
LSRAVQTYQG KNWKKIAECF PDRTDVQCLH RWQKVLNPEL VKGPWSKEED EIIVQMVNKY  120
GPKKWSTIAQ ALPGRIGKQC RERWHNHLNP AINKEAWTQE EEITLIHAHR MYGNKWAELT  180
KFLPGRTDNS IKNHWNSSVK KKVDSYMASG LLAQVPCLPL IEYPENLIEC PEYLTEGPEN  240
LIECPENGDS SSVTNRQNIE ESGCSAIGEV ENSSCGSQSS LAEIYCSQVQ NSNVALSCDL  300
QSNVDASKRD AQSSSMSQEA CYISTEGEAS ALPDLCYHVS SSNFDPEKHL EEEFDQRMSL  360
QMDTDEVPSN SLFESNQALC STANQESSLI PHDIAQEMHI SMLPDVSGAE QQLHSISNCL  420
ESDLWHGISL QSLVSGHDII DADLQPNISI SPSLICTDSE VITHSNNSVG DAEQSVKPGC  480
SDDGHGASTM MESITKCGDQ ELIDANEPMA NTETEQLSKE NENTPIEKKD DGGLFYRPPK  540
FPSLDDPFVS CDLVPSEDLP DFSPFGMRQL MRSTMENVPT PLRLWGCPTH DENSDCLLAA  600
ENFGCTPSIM KKRQRDLLSP TPDKRIEKKS GAEKDFVMIG TSHMSSAAYS KNAKSSCKEV  660
ISSKSKPAEL IVEKSSPCIN TSYEYVNLLA DTPGIKRGLE SPSAWKSPLF MQFQGSYLFS  720
PGDRSFDALG LAEQTSVHCN TVVAEARDVL ASGNRIFDEE NKENIDAKKE PGTSKLQPNI  780
IAEARVLDFN ECNTPARTAD RKPGSSLGRS ISSPILSSHN LKSFR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-68502036159MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-68502036159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00505DAPTransfer from AT5G11510Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010230653.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
RefseqXP_014753766.10.0PREDICTED: myb-related protein 3R-1-like isoform X2
SwissprotQ9S7G71e-103MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLA0A0P0Y8F40.0A0A0P0Y8F4_ORYSJ; Os12g0238000 protein
TrEMBLI1R5570.0I1R557_ORYGL; Uncharacterized protein
STRINGORGLA12G0066300.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-122myb domain protein 3r-4